PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911657.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 426aa    MW: 47526.3 Da    PI: 4.1555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911657.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42e-5171351129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd elv++yLk+kv gk++++ e+i e+++yk+ PwdLp k +++++++ewyfF++rd+ky++g+r+nrat+ gyWk+tgkd++v+
  XP_010911657.1   7 LPPGFRFHPTDVELVQYYLKRKVMGKSFQF-EAICEIELYKFAPWDLPdKsRLRSKDQEWYFFCPRDRKYPNGSRTNRATDVGYWKTTGKDRTVI 100
                     79***************************9.89**************96358888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + k+++vg+k+tL+f+ g+ap+g++tdWvm eyrle
  XP_010911657.1 101 H-KSHTVGMKRTLIFHVGKAPRGNRTDWVMYEYRLE 135
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-603157IPR003441NAC domain
PROSITE profilePS5100557.0647157IPR003441NAC domain
PfamPF023651.9E-278134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MMDKTLLPPG FRFHPTDVEL VQYYLKRKVM GKSFQFEAIC EIELYKFAPW DLPDKSRLRS  60
KDQEWYFFCP RDRKYPNGSR TNRATDVGYW KTTGKDRTVI HKSHTVGMKR TLIFHVGKAP  120
RGNRTDWVMY EYRLEDKELL NAGYSLDAYV LCKIFQKSGR GPKIGEQYGA PFNEEDWEDD  180
PIVDNAISFP CASSPKPPDD QPILLEPICE ESVAAGVCEV SSTPNLLDAD GMLLDHLAEF  240
LLGSPPYSEN ANNGISSSAV VDKNINEVCG VETGIYAELE DLCAQGGINN NLNCSGTINS  300
EYELQPVLTE LGCEQYMELN DIYSLWEGDP SDLVVPSDLF VQYPLVENPS SPNLNNMDVQ  360
NFSIGSVAAA LNDPFPAGTG MVADQSAVFL EMEDFGRSVP EMSAPVYEVD GDETILQESV  420
ASSQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-54716317171NO APICAL MERISTEM PROTEIN
1ut4_B8e-54716317171NO APICAL MERISTEM PROTEIN
1ut7_A8e-54716317171NO APICAL MERISTEM PROTEIN
1ut7_B8e-54716317171NO APICAL MERISTEM PROTEIN
3swm_A9e-54716320174NAC domain-containing protein 19
3swm_B9e-54716320174NAC domain-containing protein 19
3swm_C9e-54716320174NAC domain-containing protein 19
3swm_D9e-54716320174NAC domain-containing protein 19
3swp_A9e-54716320174NAC domain-containing protein 19
3swp_B9e-54716320174NAC domain-containing protein 19
3swp_C9e-54716320174NAC domain-containing protein 19
3swp_D9e-54716320174NAC domain-containing protein 19
4dul_A8e-54716317171NAC domain-containing protein 19
4dul_B8e-54716317171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911657.10.0PREDICTED: NAC domain-containing protein 48-like isoform X1
TrEMBLM0RQN01e-146M0RQN0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P09000_0011e-146(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.14e-83NAC domain containing protein 2